Www 2tod Com
| Www 2tod Com Directory
RCSB PDB : Structure Explorer
Are you missing data updates? The PDB archive has moved to ftp://ftp.wwpdb.org . For more information click here . ...
www.rcsb.org/pdb/cgi/explore.cgi?pdbId=2tod - 114k - 14 Feb 2008 - Cached - Similar pages |
PDB: 2TOD database: pdb entry: 2tod linkdb: 2tod header lyase 18-may-99 2tod title ornithine decarboxylase from trypanosoma brucei ...
www.genome.ad.jp/dbget-bin/www_bget?pdb+2TOD - 97k - 15 Feb 2008 - Cached - Similar pages |
2tod.com
Report on Structure 2tod Qian, J. et al. (2001) Nucleic Acids Research 29: 1750-64
bioinfo.mbb.yale.edu/pdbreport.cgi?pdb=2tod&loc=scop.berkeley.edu/&scopver=1.71&sunid=26489&tlev=px - 105k - 15 Feb 2008 - Cached - Similar pages |
PIRSF Entry D; 2TOD:A; 2TOD:B; 2TOD:C; 2TOD:D; 1D7K:A; 1D7K:B; 7ODC:A] Class: Alpha and beta proteins (a/b) ; Fold: TIM beta/alpha-barrel ; Superfamily: PLP-binding barrel ; Family: Alanine ...
pir.georgetown.edu/cgi-bin/ipcSF?id=PIRSF500127 - 59k - 18 Feb 2008 - Cached - Similar pages |
PIRSF Entry D; 2TOD:A; 2TOD:B; 2TOD:C; 2TOD:D; 1D7K:A; 1D7K:B; 7ODC:A] Class: Alpha and beta proteins (a/b) ; Fold: TIM beta/alpha-barrel ; Superfamily: PLP-binding barrel ; Family: Alanine ...
pir.georgetown.edu/cgi-bin/ipcSF?id=PIRSF001335 - 59k - 18 Feb 2008 - Cached - Similar pages |
SCOP: Search Results for 2tod Copyright © 1994-2006 The scop authors / scop@mrc-lmb.cam.ac.uk October 2006
scop.berkeley.edu/search.cgi?pdb=2tod;ver=1.71 - 111k - 15 Feb 2008 - Cached - Similar pages |
ASTRAL-PDB SEQRES sequence for 2tod PDB SEQRES sequences for 2tod (from ASTRAL ) >2todA (A:) gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp rvtpfyavacnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
scop.berkeley.edu/seq.cgi?pdb=2tod&type=pdb - 68k - 17 Feb 2008 - Cached - Similar pages |
Live Search Alexa Site Overview for 2tod.com - learn more about statistics, where visitors come from, who owns the site, what are some related links, and more. ... Sell Ad Space on Your Site ...
www.live.com/?searchonly=true&mkt=de-DE - 108k - 15 Feb 2008 - Cached - Similar pages |
SCOP: Search Results for 2tod Copyright © 1994-2007 The scop authors / scop@mrc-lmb.cam.ac.uk November 2007
scop.mrc-lmb.cam.ac.uk/scop/search.cgi?pdb=2tod;ver=1.71 - 111k - 15 Feb 2008 - Cached - Similar pages |
Links:- www.live.com/?searchonly=true&mkt=de-DE
- www.genome.ad.jp/dbget-bin/www_bget?pdb+2TOD
- scop.berkeley.edu/seq.cgi?pdb=2tod&type=pdb
- scop.berkeley.edu/search.cgi?pdb=2tod;ver=1.71
© 2004-2008 www.brsa.com.pl |